General Information

  • ID:  hor001023
  • Uniprot ID:  A0A060YTT7
  • Protein name:  CCK-7
  • Gene name:  ccka
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YLGWMDF
  • Length:  7(113-119)
  • Propeptide:  MNAGICVCVLLAAFSGSSLGRPSHSQDEDKPEPPQLDSVMSPQHTRHTRSAPSSGQLIPFSKPAEDEAEDPRTSLRELLARLISRKGSLQRSSSLSSRASGPGPSHKIKDRDYLGWMDFGRRSAEEYEEYSS
  • Signal peptide:  MNAGICVCVLLAAFSGSSLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A060YTT7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001023_AF2.pdbhor001023_ESM.pdb

Physical Information

Mass: 103828 Formula: C46H58N8O11S
Absent amino acids: ACEHIKNPQRSTV Common amino acids: DFGLMWY
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 34.29 Boman Index: 466
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 55.71
Instability Index: 4925.71 Extinction Coefficient cystines: 6990
Absorbance 280nm: 1165

Literature

  • PubMed ID:  11342099
  • Title:  Identification and Distribution of CCK-related Peptides and mRNAs in the Rainbow Trout, Oncorhynchus Mykiss